PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G331500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 385aa    MW: 42656.2 Da    PI: 7.5032
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G331500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.6e-1973120148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEde+l ++++++G g+W++ ++  g++R++k+c++rw +yl
  Sevir.1G331500.1.p  73 KGPWTPEEDEKLMEYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 120
                         79********************************************97 PP

2Myb_DNA-binding56.75.5e-18126171148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Sevir.1G331500.1.p 126 RGKFTQEEEQTILRLHSVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 171
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-2764123IPR009057Homeodomain-like
PROSITE profilePS5129419.2768120IPR017930Myb domain
SuperFamilySSF466895.24E-3370167IPR009057Homeodomain-like
SMARTSM007171.3E-1572122IPR001005SANT/Myb domain
PfamPF002493.9E-1873120IPR001005SANT/Myb domain
CDDcd001671.63E-1275120No hitNo description
PROSITE profilePS5129427.878121175IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-28124176IPR009057Homeodomain-like
SMARTSM007171.5E-17125173IPR001005SANT/Myb domain
PfamPF002496.7E-17126171IPR001005SANT/Myb domain
CDDcd001672.04E-13128171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MFNLGLGNRD FRVFIYRKLC SGDQPAKKQG ASRAKGRQQA GCLPPSQLHH PTQVPSHLSM  60
GRSPCCDENG LKKGPWTPEE DEKLMEYIQK HGHGSWRALP KLAGLNRCGK SCRLRWTNYL  120
RPDIKRGKFT QEEEQTILRL HSVLGNKWSA IAKHLPGRTD NEIKNFWNTH LKKKLIQMGF  180
DPMTHRPRTD FFAALPQLIA LANLRQLVEQ RPWDDHAARL QVEAVQAAKL QCLQNLIQSA  240
ASIATNPSSS SISTIPDLEQ IGLLSPPQMS SLSSLPSPSF LESISGQDIV AGQLPDIQIP  300
SSFSEQPTSN DANQNSDFTP KSSVEGENET PKTLLLSENS LPPLTDFPIS NFGDACSASS  360
CDGSSIQFPS WPELFDEQFL SEFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32711755108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0700450.0BT070045.1 Zea mays full-length cDNA clone ZM_BFb0376N06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953959.10.0PREDICTED: transcription factor MYB39
TrEMBLK3YU390.0K3YU39_SETIT; Uncharacterized protein
STRINGSi017785m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-102myb domain protein 93